PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00004.1.g06500.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 456aa    MW: 49012 Da    PI: 6.6563
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00004.1.g06500.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.11.3e-102873146
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                    +g W  eEd  l++ v+++G+++W++I ++  + Rt+k+c++rw +
  Zjn_sc00004.1.g06500.1.sm.mkhc 28 KGTWAVEEDAVLLEHVRLHGPRDWSSIRSKGLLPRTGKSCRLRWVN 73
                                    799************************8876677**********87 PP

2Myb_DNA-binding42.71.3e-1384124345
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                     ++++eE+   +d+ +++G++ W++Ia +++ gRt++++k++w 
  Zjn_sc00004.1.g06500.1.sm.mkhc  84 KFSPEEERVVLDLQAKFGNK-WARIATYLP-GRTDNDVKNFWS 124
                                     79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-182376IPR009057Homeodomain-like
PROSITE profilePS5129415.0712375IPR017930Myb domain
SuperFamilySSF466894.69E-2626123IPR009057Homeodomain-like
SMARTSM007175.2E-102777IPR001005SANT/Myb domain
PfamPF002492.7E-92873IPR001005SANT/Myb domain
CDDcd001672.43E-103075No hitNo description
PROSITE profilePS5129420.39476131IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-1877129IPR009057Homeodomain-like
SMARTSM007173.5E-1281129IPR001005SANT/Myb domain
PfamPF002494.7E-1284124IPR001005SANT/Myb domain
CDDcd001671.58E-1084123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MARAPGAARR RAAAGRKASG SSGESVRKGT WAVEEDAVLL EHVRLHGPRD WSSIRSKGLL  60
PRTGKSCRLR WVNKLRPNLK SGCKFSPEEE RVVLDLQAKF GNKWARIATY LPGRTDNDVK  120
NFWSTRQKRL ARLRRSPRPG RPSRNISAKK AAASSVASEF SRCFFPDQVP FEESFSSGQC  180
RAATPSMDAE NAAVIPYDQA GFQLDGLEGA FLPVEPATES QACSSDAAPL LGKTDNVDVD  240
DFWSTSQKQS GTFLCTPLPG QSSRNCGATT VAASSLQPPP AVGSFLDPVP FEGSFSAGQC  300
CAGTTCIGAQ NSELVPYDQT GSQLFDFGGA QPPPPVALAT DIQASSSNAA SLWPPPLQLY  360
QSPYPLIDFP GIPGSGDMTL GFVSAGATYD FAYHQEQLPL MQSPQMAFPI FGMHDGVKIE  420
PRGLPPDHFD DLPPDMFDSA DQLPPVSSPS RTISDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-262612925126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6630003e-41AL663000.4 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0034G17, complete sequence.
GenBankAL7316133e-41AL731613.5 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0065H10, complete sequence.
GenBankAP0149603e-41AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126123e-41CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8552183e-41CR855218.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0106P14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978165.14e-85PREDICTED: myb-related protein MYBAS2
TrEMBLK3YCT24e-85K3YCT2_SETIT; Uncharacterized protein
STRINGSi012032m1e-84(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.15e-57MYB family protein